<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL211 IL211 Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ D4T+ DDI 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35ED, M36I, R41K, H69K, L89M, I93L E34E*
>IL211| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVL*DINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39E, E40EK, E44G, K122E, D123G, I135R, A158S, K173A, D177E, T200A, Q207E, V245Q E53E*, A98LS
>IL211| codons 38-246
CEKMEKGGKISKIGP*NPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQL

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004