<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL203 IL203b Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 23
2 AZT+ NFV+ 3TC 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, M36I, R41K, H69K, L89M, I93L  
>IL203b| codons 4-99
TLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T39E, E42EG, S48T, V90I, K122E, D123G, S162Y, K173A, D177E, T200A, Q207E, E233EA, V245Q H96HN
>IL203b| codons 38-247
CEEMGKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPNP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTP
DKKHQKEPPFLWMGYALHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004