<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL160 IL160 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 AZT+ 3TC+ DDI 82
3 AZT+ DDI+ SQV 35
4 AZT+ 3TC+ SQV+ NFV 43
5 AZT+ 3TC 26
6 3TC+ NFV+ AZT 50
7 ABC+ NVP+ D4T 14
8 ABC+ EFV+ D4T 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12S, I15V, L19I, K20I, M36I, P39PS, R41K, K45R, L63T, H69K, A71IV, I93L  
>IL160| codons 4-99
TLWQRPLVSIKVGGQIIEALLDTGADNTVLEEINLSGKWKPRMIGGIGGFIKVRQYDQIT
IEICGKKVIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210LW, T215Y   K103N, G190A   T39E, K43Q, K49R, K101KQ, K102Q, K122E, D123S, I135IT, A158S, S162C, E169A, K173A, Q174K, D177E, T200A, Q207E, R211K, H221HY, V245Q  
>IL160| codons 38-247
CEELEQEGKISRIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQQNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQCSMTKILAPFRAKNPEIVIYQYMDDLYVASDLEIGQHRAKIEELREHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004