<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL105 IL105b Israel 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 77
2 D4T+ DDI+ IDV 75

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA   G16E, K20KR, M36I, P39PS, R41K, I64V  
>IL105b| codons 4-99
TLWQRPLVTIKIEGQLREALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYDQIL
VEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, T215Y       V60I, K122E, D123E, D177E, I178L, E194EK, G196E, R199*, Q207E, V245T G152GS, W153R, P225PT
>IL105b| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQSRKGSP
AIFQSSMTKILEPFRKQNPELVIYQYVDDLYVGSDLKIEQH*TKIEELREHLLRWGFYTP
DKKHQKETPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005