<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL86 IL86 Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T+ IDV 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E44D, K49KR, A98S, K122E, D123S, I135T, A158S, K173A, D177EG, T200TA, Q207E, R211K, V245Q  
>IL86| codons 43-247
KDGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKK
KKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQS
SMTKILEPFRAQNPGIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQ
KEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, M36I, R41K, H69K, L89M, I93L R87RI
>IL86| codons 4-99
TLWQRPLVTIRVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGINMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005