<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL48 IL48 Israel 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 65
2 AZT+ DDC 39
3 DDC+ IDV+ AZT 136

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, K45R, H69K, L89M, I93L  
>IL48| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N A98AG T39E, S48T, K122E, D123G, S162A, K173A, D177E, G196K, T200A, Q207N, R211K, F214FL, V245Q  
>IL48| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEIKQHRAKIEELRNHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Mutation D30N is not preferentially selected by human immunodeficiency virus type 1 subtype C in the development of resistance to nelfinavir. AAC, 2004