<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL32 IL32c Israel 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NFV 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y F77FL   A98AG K43N, V60VI, V118VI, D123E, S162A, K173I, Q174KR, D177E, T200A, Q207D, R211K, V245Q D185DA, E203EDKN
>IL32c| codons 38-247
CTELENEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDLRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRIRNPEIVIYQYMADLYVGSDLEIGQHRAKINELRDHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10V, I13V, K20I, M36I, P39L, R41K, I62V, L63P, H69K, L89M  
>IL32c| codons 4-99
TLWQRPVVTVKIGGQLIEALLDTGADDTVLEEINLLGKWKPKIIGGIGGFIKVRQYDQVP
IEICGKKAIGTVLVGPTPVNIIGRSMLTQIGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005