<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL32 IL32b Israel 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S L10LF I13V, K20I, M36I, P39L, R41K, I62V, L63P, H69K, L89M  
>IL32b| codons 4-99
TLWQRPFVTVKIGGQLIEALLDTGADDTVLEEINLLGKWKPKIIGGIGGFIKVRQYDQVP
IEICGKKAIGTVLVGPTPVNIIGRSMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T215FY       D123E, S162A, K173I, Q174K, D177E, T200A, Q207DE, R211RK, V245Q P59S, E89EK
>IL32b| codons 39-247
TELEKEGKISKIGPENPYNTSVFAIKKKDSTKWRKLVDFRELNKRTQDFWKVQLGIPHPA
GLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQASMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPD
KKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005