<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IL201 IL201c Israel 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 30
2 IDV+ DDI+ D4T 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       T39E, K122E, D123S, I135V, I142K, Q145V, A158S, K173A, Q174K, D177E, I180IL, T200A, Q207G, R211K, V245Q  
>IL201c| codons 37-247
ICEEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSVNNETPGKRYVYNVLPQGWKGS
PSIFQSSMTKILEPFRAKNPEIVLYQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFYT
PDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, I15V, L19T, M36I, L63P, I64L, H69K, L89T, I93L  
>IL201c| codons 4-99
TLWQRPIVSIKVGGQTKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQIP
LEICGKKAIGTVLVGPTPVNIIGRNTLTQLGCTLNF

References
Author Title Citation
Grossman, Z Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005