<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JLB_Pat57 HIM419483 Denmark 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, N37NS, I62V, L63LP, I64V  
>HIM419483| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31IL, K102Q, D123E, S162A, K173KQ, I202V, Q207K, R211A, A272P, I293V, K311R, S322A, D324E  
>HIM419483| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRQQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRKHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPAKE

References
Author Title Citation
Jorgensen, LB Prevalence of drug resistance mutations and non-B subtypes in newly diagnosed HIV-1 patients in Denmark. Scand J Infect Dis, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005