<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JLB_Pat19 HIM419445 Denmark 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33V, E35D, M36I, R41K, K45R, L63P, H69K, L89M  
>HIM419445| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVVEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179VD E6D, K11T, V35T, T39K, K43E, V60VI, K122E, D123NS, I135L, E138G, T165I, R172K, K173L, Q174K, D177E, Q207A, R211S, V245E, A272P, K275KQ, K277R, T286A, E291D, V292I, I293V, E312T  
>HIM419445| codons 1-324
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNGTPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFKLKNPEIDI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKD

References
Author Title Citation
Jorgensen, LB Prevalence of drug resistance mutations and non-B subtypes in newly diagnosed HIV-1 patients in Denmark. Scand J Infect Dis, 2003