<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JLB_Pat4 HIM419430 Denmark 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20R, E35D, M36I, N37D, R41K, R57K, H69K, K70KR, L89M  
>HIM419430| codons 1-99
PQITLWQRPLVTVRIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39X, V60I, D121H, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, Q207A, R211S, D250E, A272Q, T286A, E291D, V292I, I293V, P294T, E312D  
>HIM419430| codons 1-313
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICXEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYQGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDP

References
Author Title Citation
Jorgensen, LB Prevalence of drug resistance mutations and non-B subtypes in newly diagnosed HIV-1 patients in Denmark. Scand J Infect Dis, 2003