<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1271 CA4213 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 D4T 100
4 3TC+AZT 35
5 3TC+AZT+IDV 22
6 3TC+D4T+IDV 13
7 3TC+D4T+IDV+NVP 4
8 3TC+RTV+SQV 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M G73GC E35D, M36I, N37E, R41K, L63P, K70T, V77I, I93L  
>CA4213| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEDIELPGKWKPKIVGGIGGFIKVRQYD
QIPIEICGHTAICTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     K20R, T39A, E44D, V118I, K122E, K126KE, I135T, D177E, H208Y, R211N, L283I, R284K, I293V K220KR
>CA4214| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFREYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWNWGFYTPDNRHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005