<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KF_Pat48 00CM3616 Cameroon 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36L, N37S, R41K, H69K, K70R, L89M  
>00CM3616| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Konings, FAJ Protease mutations in HIV-1 non-B strains infecting drug-naive villagers of Cameroon. ARHR, 2004