<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KSC_pat8 KSC-8 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47V, I54VPS, V82A, L90M L33F, K43T, T74PS L10V, I13V, I15V, N37D, L63P, A71V, I93L  
>KSC-8| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADDTIFEEMDLPGRWTPKLVGGIGGFVKVRQYD
QIPIEICGHKVIGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q     K20KR, E40ED, V60I, A98S, K122E, I135T, D218E, L228H  
>KSC-8| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTDLEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005