<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y V75A, K219N Y181C, G190A V108I K20KR, V35M, T39A, E40F, K43E, S68G, L109I, V118I, K122E, V179I, R211K, L228H, A272P K103G
>KSC-6| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAFLEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKIADFRELNKRTQDFWEVQLGIPHPAGLKKGKSVTIIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, L90M L10F, L33F, F53FL, Q58E E34Q, N37H, R41K, K55R, R57K, D60E, L63P, A71V  
>KSC-6| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTIFQEMHLPGKWKPKIVGGIGGLLRVKEYE
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012