<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1288 CA4202 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 3TC+AZT 26
3 3TC+AZT+IDV 43
4 AZT+DDI+IDV+NVP 17
5 3TC+D4T+RTV+SQV 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37A, R41K, I62V, L63A, A71V, V77I, I93L  
>CA4202| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMALPGKWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   K103N   K122E, D123N, I135X, Q207E, R211K, F214L, V245T, K277R, V292I, I293V, E297A  
>CA4201| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEIVPLTAEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005