<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ZP_Pat3 00CM1423 Cameroon 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12A, I13V, I15V, Q18K, L19I, M36I, N37D, R41K, C67Y, H69K, I72M, L89I  
>00CM1423| codons 1-99
PQITLWQRPIVAVKVGGKIKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAMGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Zhong, P Genetic and biological properties of HIV type 1 isolates prevalent in villagers of the Cameroon equatorial rain forests and grass fields: further evidence of broad HIV type 1 genetic diversity. ARHR, 2003