<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17694 CA41631 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 65
2 3TC+D4T 22
3 3TC+D4T+IDV 256
4 3TC+D4T+NFV 134

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62V, D67G, K219R   V108I K20R, K43Q, E44D, K102S, V106I, T107A, V118I, K122E, Q174E, G196E, H208Y, R211K, K223Q, L228H, E297K K350E
>CA41631| codons 1-354
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FVIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKSKKSIAILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDRKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLETGKY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20I, L63LP, I64V, K70R, A71AV, V77I, I93IL  
>CA41630| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHRVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005