<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17692 CA41626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+IDV 239
3 ABC+D4T+EFV 126
4 DDI+EFV+TDF 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, L19I, N37S, L63Q, I64IV, V77I  
>CA41626| codons 1-99
PQITLWQRPLVTIRIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR   L100LI, K103N   P4S, R211K, V245VAMT, K277R, T286TA, I293V, E297Q, I329L, G335S  
>CA41627| codons 1-348
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQSQWTYQIYQEPFKN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005