<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17690 CA41623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+EFV 61
2 None 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      A98G E6ED, K20KR, K122KE, D123DN, A158AS, S162A, E169D, G196GE, T200D, K201KR, I202V, E204EK, F214L  
>CA41623| codons 1-268
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRDRVEKLRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWAS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14KR, E35D, R57K, Q61E, L63P, I64V, A71T, I72IM, V77I, I93L  
>CA41622| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
EIPVEICGHKTMGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005