<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17687 CA41617 U.S. 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+EFV+TDF 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N V108VI V35T, T39TA, E40ED, V60I, V90VI, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, F214L, H221HY, V245R, E248N  
>CA41617| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIRLPNKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12N, I13V, L19P, K20I, M36I, R41K, L63S, I64L, H69K, K70R, L89M  
>CA41616| codons 1-99
PQITLWQRPIVNVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISLEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009