<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17675 CA41592 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+NFV+NVP 86

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35Q, N37E, R57K, I62V, L63P, A71T, I72V, V77I, I93L  
>CA41592| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEQMELPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKTVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122KE, K166KR, D177DE, Q197QE, Q207AE, R211K, A272P, K277R, I293V, E297R  
>CA41593| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGEHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTREAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009