<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17642 CA41526 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 65
2 D4T 52
3 3TC+AZT+SQV 9
4 3TC+AZT+IDV 65
5 3TC+AZT+RTV+SQV 39
6 3TC+DDI+NFV 44
7 ABC+DDI+EFV+NFV 35
8 D4T+DDI+IDV+RTV 39
9 3TC+D4T+LPV 179

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, L76V, I84V, L90M K43T, G73T L10I, I13M, E34Q, Q61R, I62V, L63P, I64V, I66V, C67F, H69R, I72V, I93L, C95V  
>CA41526| codons 1-99
PQITLWQRPIVTMKIGGQLKEALLDTGADDTVLQEMNLPGRWTPKIVGGIGGFVKVRQYD
RVPVEVFGRKAVTTVVVGPTPVNVIGRNLMTQLGVTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N L100I, K103N F227L, K238T P9PS, V35L, T39A, K43Q, E44D, V60I, V118I, K122KE, I135V, S162SN, D177G, I195K, G196E, E203K, Q207E, H208Y, R211K, K223E, L228H, Q242QH, A272P, L283I, I293V  
>CA41527| codons 1-300
PISPIETVSVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEQDGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEKEQHRTKIKELREYLWKWGFYTPDNKHQEEPPLHWMGYELHPDTWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005