<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA17599 CA41438 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 104
2 3TC+D4T+IDV 130
3 3TC+D4T+LPV 96
4 DDI+EFV+TDF 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A L23I L10I, I15V, I62V, L63V, H69R, A71V, I72K, L89M, I93L  
>CA41438| codons 1-99
PQITLWQRPIVTIKVGGQLKEAILDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QVVIEICGRKVKGTVVVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V, L210W, T215Y   G190E   V35T, S48T, S68G, V118I, D123E, D177E, R211Q, A272P, K277R, I293V  
>CA41439| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVESDLEIGQHRTKIEELRQHLWQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005