<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0928 0928 Belgium 2014 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, P39T, R41K, R57K, D60E, Q61N, H69Y, I72T, L89M  
>0928| codons 9-99
PVVTVKIEGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYENILIEICG
YKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, D123E, I135L, S162C, E169D, K173A, Q174K, D177E, I178L, Q207D, R211A  
>0928| codons 41-239
MEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIF
QCSMTKILDPFRAKNPELVIYQYMDDLYVGSDLEIGQHRTKIEELRDHLLAWGFTTPDKK
HQKEPPFLWMGYELHPDKW

References
Author Title Citation
Verhofstede, C Decision tree for accurate infection timing in individuals newly diagnosed with HIV-1 infection. BMC Infect Dis, 2017