<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14684 CA41352 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 70
2 AZT+DDI+IDV+NFV+RTV 61
3 None 13
4 APV+D4T+DDI+RTV 170
5 None 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54LV, V82A L10F, L24I T12PS, K14KR, I15V, R41RK, L63P, I64V  
>CA41352| codons 1-99
PQITLWQRPFVSIRVGGQLKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR       V35I, T69TN, K102Q, V106VI, K122E, D123N, I132V, I135T, E169D, F214L  
>CA41353| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSITVLDVGDAYFSVPL
DENFRKYTAFTVPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005