<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5481 CA41347 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 65
3 AZT+DDC+SQV 65
4 D4T+DDI+NFV+NVP 4
5 D4T+DDI+NFV 35
6 3TC+AZT+IDV+RTV 131
7 3TC+ABC+EFV 48
8 ABC+D4T+EFV 110

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, L210W, T215FY K219Q Y188L K238T K22KR, T39N, E44D, V60I, V118I, K122E, I135L, T139I, E203ED, Q207E, H208HY, D218DE, L228H, K277R  
>CA41347| codons 1-285
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICNELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIDELREYLWRWGFYTPEQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37T, P39PS, I64V, V77VI  
>CA41346| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLSGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009