<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6507 CA41344 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 13
2 D4T+DDI+IDV 130
3 D4T+DDI+NFV+NVP 17
4 None 126
5 3TC+AZT+LPV 30
6 DDI+LPV+TDF 57
7 ABC+LPV+TDF 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90LM L33F L10I, E35D, M36I, N37E, K55R, L63P, K70R, A71V  
>CA41344| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIFEDIELPGRWKPKIVGGIGGFMRVRQYD
QIPIEICGHRVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, K219E Y181C, G190A   A33V, V35I, T39S, R83K, K101Q, K122E, G196E, E203K, V245T  
>CA41345| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLIEICSEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIKELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009