<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1443 CA41328 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 DDC 64
3 D4T 30
4 D4T+IDV 6
5 3TC+D4T+IDV 79
6 3TC+D4T+DLV+NFV+SQV 55
7 3TC+D4T+NFV+SQV 196
8 3TC+ABC+APV+D4T+DDI+LPV 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82VA, I84IV L24I, L33LF L10I, D60DE, L63P, I64IV, A71AV, I72V, I93IL G94GS
>CA41328| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKLIGGIGGFVKVRQYE
QIPVEICGHKVVGTVLVGPTPANVIGRNLLTQLSCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, M184V, L210LW, T215Y       K49KR, V60VI, V118VI, D123E, I135T, S162DN, D177E, V179VI, T200TA, V245E, A272S, K277R D110DN
>CA41329| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLNVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLC

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005