<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4374 CA41303 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 83
2 D4T+NFV+NVP 30
3 3TC+AZT+SQV 22
4 None 48
5 D4T+EFV+IDV+RTV 104
6 ABC+APV+D4T+DDI+LPV 117

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75VIM, K219E K103KNRS, Y181C V108VI P4S, K11KT, T39TA, V60I, V90I, V118I, D123E, S162D, V179I, I195L, R211T, D218E, L228H, A272P, K281R, T286A, E297K Q242QHKN
>CA41303| codons 1-300
PISSIETVPVTLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEIQLGIPHPAGLKKSKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLELGQHRTKIEELRQHLWTWGFYTPEEKHQKEPPFHWMGYELHPDKWT
VNPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, L90M L33F, G73GACS L10I, I13V, G16GA, E34EQ, K43S, L63P, A71T, I72IL, I93L  
>CA41302| codons 1-99
PQITLWQRPIVTVKIAGQLKEALLDTGADDTIFQEMNLPGRWSPKIVGGIGGFLKVRQYD
QIPIEICGHKTLSTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012