<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5994 CA41300 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 112
2 AZT+ 3TC 30
3 AZT+ 3TC+ IDV 130
4 D4T+ EFV+ NFV 78
5 D4T+RTV+SQV 161

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, L90M F53L, N88D K20R, E35D, M36I, N37T, R41K, L63P, I93L  
>CA41300| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDITLPGKWKPKIIGGIGGLIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74LV   L100LI, K103KN   K64R, A98AS, K122KE, S163SN, D218DE, E224ED, K277R, T286A, V292I, E297K  
>CA41301| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTRWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSNMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEKKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009