<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3978 CA41292 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 3TC+AZT 22
3 3TC+AZT+IDV 74
4 DDI+NFV+NVP 61
5 D4T+NVP+SQV 21
6 APV+D4T+NVP+SQV 39
7 3TC+ABC+DDI+LPV 187

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M L10F, L33F I13V, G16A, N37D, K55R, R57K, L63P, A71V, I93L  
>CA41292| codons 1-99
PQITLWQRPFVTVKIAGQLKEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFVRVKQYD
QIPIEICGHKVIGTVVVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K101E, Y181C, G190A V108VI E28K, K32E, V35L, T39A, K43E, K64KR, V118I, K122E, I135T, G196E, R211K, L228HQ, V245Q, I293V, E297K  
>CA41293| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALLEICAELEEEGKISKIGPENPYNTPV
FAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFQWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005