<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9860 CA41284 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 65
2 AZT+DDI 70
3 3TC+AZT+IDV 252
4 3TC+D4T+RTV+SQV 70
5 D4T+DDI+EFV 114

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V   L10V, I13V, E35D, M36I, N37D, I62V, L63P, I66FV, H69R, A71T, I72M  
>CA41284| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEVCGRKTMGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K101P, K103N   K20R, T39S, E44D, V118I, K122KE, I135IL, T200S, R211E, T286A, E297A, K311R  
>CA41285| codons 1-350
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICSELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRSKIEELRQHLWEWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTAEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLK

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009