<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9752 CA41283 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ D4T 38
2 D4T+NFV+TDF 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     V21VI, T69S, I135V, K173E, P243S, V245K N137NH
>CA41283| codons 1-252
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNHETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKDSW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23I, Q58QE E35D, R41K, L63P, V77I, V82I, I93L  
>CA41282| codons 1-99
PQITLWQRPLVTIKIGGQLKEAILDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVREYD
QIPIEICGHKAIGTVLIGPTPINIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012