<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4812 CA41269 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 110
2 AZT+DDI 40
3 3TC+AZT 94
4 DLV+NFV+SQV 116
5 APV+D4T+DDI 17
6 D4T+DDI 14
7 3TC+DDI+IDV+NFV+RTV 9
8 3TC+APV+DDI+NFV+RTV 24
9 3TC+EFV+LPV 159

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T215C L100I, K103N   E6D, V35M, T39A, K43E, V111I, D123E, I142V, D177E, I178L, H208Y, R211K, L228H, A272P, K277R, T286A, I293V  
>CA41269| codons 1-301
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFCTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, I13IV, L63P, I64L  
>CA41268| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009