<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4805 CA41262 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 65
2 IDV+ D4T+ 3TC 139
3 NFV+ EFV+ ABC 52
4 APV+ DDI+ D4T+ LPV 113
5 APV+D4T+DDI+DLV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F N37D, R57K, I62V, L63P, C67S, A71V, V77I, I93L  
>CA41262| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVKQYD
QVPIEISGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y   K103N A98AG V60I, K122E, I135M, S162Y, Q197QE, T200A, S251C, A272P, I293V, E297AT, S322T, Q334E  
>CA41263| codons 1-350
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDCWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGEGQWTYQIYQEPFKNLK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005