<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4305 CA41259 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 218
2 3TC+AZT 22
3 3TC+AZT+RTV 61
4 3TC+AZT+NVP 48
5 D4T+DDC+NFV 48
6 3TC+D4T+EFV+IDV 101
7 D4T+DDI+SQV 30
8 3TC+ABC+AZT+SQV 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_GS, M184MIV, T215Y A62V Y181YC, G190GA   E6K, V35VL, K64R, K101Q, K122E, I135V, Y144F, T200A, E204D, L228H, A272P, I293V  
>CA41259| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FVIRKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRFQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRAKIEDLRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48GV, I54V, V82VA F53FL, N88ND L10LI, I15V, E35D, M36I, N37D, L63LP, A71AV, T74TK, V75VI  
>CA41258| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKIIVGIGGLVKVRQYD
QIPIEICGHKVIGKILVGPTPANIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005