<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4307 CA41254 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 3TC+D4T+IDV 35
3 DDI+RTV+SQV 61
4 D4T+DDI+RTV+SQV 44
5 3TC+D4T+IDV+RTV 13
6 3TC+D4T+IDV+NVP+RTV 74
7 None 22
8 ABC+APV+AZT+DDI+LPV 52
9 3TC+APV+AZT+DDI+LPV 31
10 3TC+D4T+LPV+TDF 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84V   L10IV, I13V, I15V, L19I, K20M, N37NS, L63LP, I64V  
>CA41254| codons 1-99
PQITLWQRPVVTVKVGGQIMEALLDTGADDTILEEMSLPGRWKPKIVGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103KN   V118I, K122E, I178M, T200A, K277R  
>CA41255| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009