<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7938 CA41246 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 135
2 3TC+AZT 48
3 3TC+D4T+NFV 187
4 D4T+DDI+EFV 150

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, K20V, M36I, I62V, L63P, A71T, I72IT  
>CA41246| codons 1-99
PQITLWQRPLVTIKVGGQLVEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTTGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N, Y188FL K238KT E6K, E28R, K32E, S68G, K122E, I135V, S162C, T200A, K277R, L283I, I293V, P294Q  
>CA41247| codons 1-324
PISPIKTVPVKLKPGMDGPKVKQWPLTREKIEALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGTKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009