<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7072 CA41239 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 44
2 AZT+DDC+IDV 74
3 3TC+D4T+RTV+SQV 74
4 3TC+APV+D4T+EFV 95
5 3TC+AZT+LPV+TDF 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N A98G E6K, K43KQ, E44D, V118I, K122E, D123E, I135V, I142V, S162C, T200A, R211K, V245E, A272P, K277R, E297K  
>CA41239| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54IMV, V82A, L90M L33F, F53L, G73GA L10I, T12TA, I13V, G16A, N37D, L63P, I64IV, G68GE, A71V  
>CA41238| codons 1-99
PQITLWQRPIVAVKIAGQLKEALLDTGADDTIFEEMDLPGRWKPKIVGGIGGLVKVRQYD
QIPVEICEHKVIATVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005