<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2308 CA41236 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 17
2 3TC+AZT+IDV 104
3 D4T+DDI+NFV 57
4 ABC+APV+DDI+RTV+SQV 42
5 3TC+D4T+DDI+EFV 81
6 3TC+LPV+SQV+TDF 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M L10F, K43T, G73S, L89V T12E, I13V, G16E, K20M, M36L, R41R_R, L63H  
>CA41236| codons 1-99
PQITLWQRPFVEVKIEGQLMEALLDTGADDTVLEELNLPGRWTPKIIGGIGGFVKVRQYD
QIHIEICGHKAISTVLVGPTPANVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M K101E   K20R, E28EK, K43KE, V60I, V118I, I135T, Q207H, D237E, P294Q, I329L  
>CA41237| codons 1-350
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRHHLWRWGFYTPDKKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005