<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1169 CA41235 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 226
2 AZT+DDC 35
3 3TC+AZT 44
4 3TC+AZT+SQV 22
5 3TC+AZT+NVP 17
6 3TC+D4T+NFV 15
7 3TC+D4T+RTV+SQV 37
8 3TC+D4T 36
9 3TC+D4T+IDV 225
10 Unknown 33

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y D67G, V75M, F77L     T39X, K43KQ, E44D, A98S, K101Q, V118I, K122E, V148G, A158S, S162D, T286A, E297K, V317VA, S322T, I329V  
>CA41235| codons 1-355
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICXELEQDGKISKIGPENPYNTPV
FAIKKKGSDKWRKLMDLRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNGLPQGWKGSPSIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGAYYDPTKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M K43T L10I, K20KR, M36MI, I62V, L63P, A71V, I72E, I93L  
>CA41234| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGRWTPKIIGGIGGFVKVRQYD
QVPIEICGHKVEGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005