<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5544 CA41232 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 113
2 3TC+AZT+IDV 113
3 None 74
4 3TC+D4T+NVP 22
5 None 122
6 3TC+D4T+EFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37S, P39S, L63P, H69Y, A71V, V77I, I93L  
>CA41232| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLSGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215C K103N, Y181C V179E I135V, I142V, I178M, G196E, F214L, V245N, V261X, A272P, K277R, T286V, E297Q  
>CA41233| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMEI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLCTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPEKDSWTVNDIQKLXGKLNWASQIYPGIKVRQLCKLLRGVKALTEVIPLTQEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005