<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1263 CA41214 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 52
3 DDI 96
4 D4T 9
5 3TC+AZT 39
6 3TC+AZT+IDV 60
7 3TC+AZT+RTV+SQV 49
8 3TC+D4T+RTV+SQV 46
9 3TC+DDI+EFV+RTV+SQV 7
10 3TC+DDI+RTV+SQV 44
11 3TC+DDI+RTV+SQV 221

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23I, F53L, G73S L10I, I62V, L63P, H69HY, A71T, V77I, I85V  
>CA41214| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLPGRWKPKMIGGIGGLIKVRQYD
QVPIEICGYKTISTVLIGPTPVNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215D     K11R, K122KE, I142V, S162C, T200A, I202V, E203K, Q207E, V245I, A272P, V292VI, I293V, K311R, V314VI, F346L  
>CA41215| codons 1-351
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKVKELREHLLRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILREPIHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPLKNLKT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005