<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5966 CA41210 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 52
2 AZT+3TC 65
3 D4T+DDI+NVP 47
4 3TC+AZT+NFV+NVP 279

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, I15V, E35D, M36I, N37T, K45R, I62V, L63P, I64V, V75I, Q92K  
>CA41210| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADNTVLEDITLPGRWKPRMIGGIGGFIKVRQYD
QVPVEICGHKAIGTILVGPTPVNIIGRDLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   G190A K101H I135T, R211K, E248EV, A272P, K277R, V314VI, I329L  
>CA41211| codons 1-348
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPVKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPIHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005