<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6401 CA41206 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 3TC+D4T+IDV 48
3 3TC+D4T+RTV+SQV 126
4 3TC+AZT+EFV 30
5 D4T+IDV+RTV 72
6 DLV+EFV+LPV 119

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T N37D, L63P, I64V, I66V, H69Y, K70R, V77I, I93L  
>CA41206| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QIPVEVCGYRAITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, T215Y   K101E, Y181C, G190S V108I P4T, K20R, V35I, K43N, E44D, V106I, K122E, V189I, H208Y, L210E, R211K, K223Q, L228K  
>CA41207| codons 1-300
PISTIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSITILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYISSDLEIGQHRTKIEELRQYLEKWGFYTPDKKHQQEPPFKWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005