<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7106 CA41204 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 139
2 D4T+DDI+EFV 44
3 3TC+D4T+DDI+NFV 9
4 3TC+DDI+NFV 69
5 3TC+DDI+NFV+RTV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I54L, L90M L33F, N88D L19LI, I62V, L63P, A71T, V77I, V82I, I93L  
>CA41204| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADNTVFEEMNLPGRWKPKIIGGIGGFLKVRQYD
QVPIEICGHKTIGTVLIGPTPINIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       S68SN, V118I, K122KE, T200I, Q207E, R284K, I293V, P294T, E297K, E300EK, P313T W252W*, G333EK
>CA41205| codons 1-361
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDS*TVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVTLTKEAK
LELAENREILKETVHGVYYDPSKDLIAEIQKQKQGQWTYQIYQEPFKNLKTGKYARMRGA
H

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005