<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2076 CA41195 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 31
2 D4T+IDV 48
3 D4T+NFV+NVP 23
4 3TC+AZT+NFV+NVP 10
5 3TC+ABC+AZT+EFV 30
6 D4T+DDI+RTV+SQV 203

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KN Y188L   K43E, E44A, V60VI, K102M, V118I, K122E, I142IV, S162SN, V179VI, H208HY, R211N, A272P, E291D, I293V  
>CA41195| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIII
YQYMDDLLVGSDLEIGQHRTKIEELRQYLWNWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84V, L90M   L10R, I13IV, K14E, L19V, K20T, E35G, M36I, R57K, Q61E, I62V, L63P, I64V, E65N, A71V, P79A, Q92K, I93L  
>CA41194| codons 1-99
PQITLWQRPRVTVEIGGQVTEALLDTGADDTVLEGINLPGRWKPKLIGGIGGFLKVKQYD
EVPVNICGHKVIGTVLVGATPVNVIGRNLMTKLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005