<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NJIH0036 NJIH0036 Nigeria 2013 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V   K101E, Y181C, G190A   K20KR, V35T, V60I, D121H, K122E, E138A, S162SC, F171Y, K173A, Q174K, D177E, I178IL, T200A, Q207N, R211K, V245Q, E248D, D250E  
>NJIH0036| codons 1-254
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAFFSVPL
HEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRAKNPELVI
CQYVDDLYVASDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, C67E, H69R, V82I, L89M  
>NJIH0036| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEIEGRKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Chaplin, B Distinct Pattern of Thymidine Analogue Mutations with K65R in Patients Failing Tenofovir-Based Antiretroviral Therapy. ARHR, 2017